PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK11834.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family GRAS
Protein Properties Length: 311aa    MW: 35942.4 Da    PI: 4.473
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK11834.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS108.77.7e-343163158322
       GRAS 158 leetgerLakfAeelgvpfefnvl.vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadh..nsesFl 254
                ++e+ +r++kfA+ +gvpfefnv+   +rl +l+ e+L ++ +Ea+aVn+v  l r       +e+ r++ ++++ sl+P++v+vve+ead   ++e+F+
  PK11834.1   3 MKEISQRMEKFARLMGVPFEFNVVsELSRLGELTRERLGIQDDEAVAVNCVGTLRRAE-----VED-REAAMRAFLSLKPRIVTVVEEEADFtsTREDFV 96 
                799********************85556************************999997.....555.7799******************998556679** PP

       GRAS 255 erflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleea 322
                  f e+l++y+  fd+le++++r+s+e+ ++Ere  +r iv+v+ac  ++  e++   ++ +++ +++
  PK11834.1  97 GCFEECLRFYTLYFDMLEESFGRTSNEKLMLERE-CSRGIVSVLACDDDQDYEDQSLDHQYHDQQMNC 163
                **********************************.89**********999888777666666655555 PP

2GRAS21.82.1e-07208253304348
       GRAS 304 errerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdg 348
                +  er+e+ ++W+e+l++  F+pv +s+++ +++k+ll++++ ++g
  PK11834.1 208 DCSERREKGKQWSEKLKRGSFRPVGYSDDVLDDVKALLKRYPpGWG 253
                5679*************************************96665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098519.6781258IPR005202Transcription factor GRAS
PfamPF035142.7E-313163IPR005202Transcription factor GRAS
PfamPF035147.2E-5208253IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
XVMKEISQRM EKFARLMGVP FEFNVVSELS RLGELTRERL GIQDDEAVAV NCVGTLRRAE  60
VEDREAAMRA FLSLKPRIVT VVEEEADFTS TREDFVGCFE ECLRFYTLYF DMLEESFGRT  120
SNEKLMLERE CSRGIVSVLA CDDDQDYEDQ SLDHQYHDQQ MNCGPGEEGN DDQNNDNNSN  180
NDINDSNNNN NFKDGRTRRR TNTTSTWDCS ERREKGKQWS EKLKRGSFRP VGYSDDVLDD  240
VKALLKRYPP GWGLVHHQPQ SIINGPDQRQ QEQQERQLLV YDDSNSITSA SAGIYLTWKE  300
EPVVWASAWK I
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015935352.11e-99PREDICTED: protein SHORT-ROOT-like
TrEMBLA0A0B2RFI71e-95A0A0B2RFI7_GLYSO; Protein SHORT-ROOT
TrEMBLI1MD471e-95I1MD47_SOYBN; Uncharacterized protein
STRINGGLYMA15G03290.13e-95(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF129734106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37650.11e-38GRAS family protein